Analytical Data
-
Gene name
PLEKHA6
- Application
-
Alternative Names
KIAA0969; PEPP 3; PEPP-3; PH domain-containing family A member 6; Phosphoinositol 3 phosphate binding protein 3; Phosphoinositol 3-phosphate-binding protein 3; PKHA6_HUMAN; Pleckstrin homology domain containing family A member 6; Pleckstrin homology domain-containing family A member 6; PLEKH A6; PLEKHA 6; PLEKHA6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2H5
-
Expression Region
1-30 aa
-
AA Sequence
MHPRWAARLPLFISLLERADSVTAAYAKQH
-
Molecular Weight
29.04 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLEKHA6 (pleckstrin homology domain-containing family A member 6) is a member of the pleckstrin homology (PH) domain-containing protein family, which is known for its role in various cellular processes, including signal transduction, membrane trafficking, and cytoskeletal organization. Research indicates that PLEKHA6 is associated with the regulation of specific intracellular pathways and may play a significant role in cancer progression and neurobiology. The characterization of PLEKHA6 recombinant proteins has become increasingly important in understanding its functional mechanisms and biological significance. Researchers have focused on producing and purifying PLEKHA6 recombinant proteins to facilitate investigations into its structural properties and interactions with other cellular proteins. This research aims to elucidate the molecular mechanisms underlying PLEKHA6's functions and its potential implications in disease contexts. By studying PLEKHA6 and its interactions, scientists hope to uncover novel therapeutic targets and strategies for diseases where PLEKHA6 is implicated, contributing to the broader field of molecular biology and therapeutic development. With advancements in recombinant protein technology, the detailed study of PLEKHA6 is expected to provide insights that could lead to innovative approaches in treating conditions linked to this protein's dysfunction.
