Analytical Data
-
Gene name
FcgR3A
- Application
-
Alternative Names
FcgR3A；CD3Z；T-cell surface glycoProtein CD3 zeta chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08637
-
Expression Region
17-208aa
-
AA Sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESL ISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRW VFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKD SGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQHHHHHH
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fc gamma receptor IIIA (FcgR3A) is a critical component of the immune system, primarily involved in the recognition and clearance of antibody-coated pathogens through processes such as antibody-dependent cellular cytotoxicity (ADCC). It is predominantly expressed on natural killer (NK) cells, macrophages, and some other immune cells, where it plays a pivotal role in mediating immune responses and contributing to the efficacy of therapeutic antibodies in cancer and infectious diseases. The study of FcgR3A recombinant protein is vital for understanding its structural and functional dynamics, which can provide insights into its role in immunological processes. Recent research has focused on characterizing the binding affinity of FcgR3A to different antibodies, elucidating its signaling mechanisms, and exploring its interactions with various ligands. By employing recombinant technology, researchers can produce this receptor in larger quantities for functional assays, structural studies, and as a potential therapeutic target. Additionally, investigating FcgR3A polymorphisms has been instrumental in understanding variations in immune responses among individuals, which can influence the clinical outcomes of antibody therapies. Overall, the research on FcgR3A recombinant protein holds significant promise for enhancing our understanding of immune regulation and improving the design of novel immunotherapeutics.
