Analytical Data
-
Gene name
Pkdcc
- Application
-
Alternative Names
Pkdcc；SGK493；VLK；Extracellular tyrosine-Protein kinase PKDCC
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q504Y2
-
Expression Region
33-493aa
-
AA Sequence
PRPGQSPEPSPAPGPGRRGGRGELARQIRARYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLPRPRPPWARPLSDGAPGWPPAPGPGSPGPGPRLGCAALRNVSGAQYMGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVREFGVRRGCYRLAAHKLLKEMVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG
-
Molecular Weight
54.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Pkdcc, also known as Protein Kinase DCC, is a member of the protein kinase family that plays a crucial role in various cellular processes, including cell signaling, proliferation, and survival. The study of Pkdcc is particularly significant in the context of its potential implications in cancer biology and neurodegenerative diseases. Research has indicated that dysregulation of protein kinases, including Pkdcc, can lead to abnormal cellular behaviors that contribute to tumor progression and metastasis. As a result, understanding the structure and function of Pkdcc may uncover valuable insights into the molecular mechanisms underlying these diseases. Additionally, Pkdcc has been identified as a potential therapeutic target, raising the need for the development of recombinant Pkdcc proteins for both functional studies and drug development. Recombinant protein technology allows for the generation of large quantities of pure, active Pkdcc, enabling researchers to investigate its biochemical properties and interactions with other cellular components. Furthermore, studying the effects of Pkdcc in various model systems can provide a deeper understanding of its physiological roles and potential as a target in therapeutic contexts. Therefore, research focusing on the recombinant expression and characterization of Pkdcc is vital for unveiling its functional significance and developing strategies for combating diseases associated with its dysfunction.
