Analytical Data
-
Gene name
PRLHR
- Application
-
Alternative Names
PRLHR; GPR10; GR3; Prolactin-releasing peptide receptor; PrRP receptor; PrRPR; G-protein coupled receptor 10; hGR3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49683
-
AA Sequence
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI
-
Molecular Weight
41.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRLHR (prolactin-releasing hormone receptor) is a crucial player in the endocrine system, primarily involved in the regulation of prolactin secretion from the pituitary gland. Research on PRLHR has gained momentum due to its potential implications in various physiological and pathological processes, including lactation, reproductive health, and metabolic regulation. Prolactin, a hormone produced by the anterior pituitary, plays significant roles beyond lactation, influencing immune responses, behavior, and water balance. Dysregulation of PRLHR signaling can lead to conditions such as hyperprolactinemia, infertility, and even certain cancers. The recombinant expression of PRLHR has become a focus of scientific investigation, allowing researchers to dissect its structure-function relationship and explore its interactions with other signaling molecules. Advanced techniques in protein engineering and molecular biology have facilitated the production and characterization of recombinant PRLHR proteins, enabling studies on ligand binding dynamics, receptor activation mechanisms, and downstream signaling pathways. Understanding the nuances of PRLHR function through recombinant proteins can provide valuable insights into its role in health and disease, potentially leading to novel therapeutic strategies for conditions associated with prolactin dysregulation. As such, PRLHR not only serves as a fundamental aspect of endocrinology but also represents a promising target for future research aimed at addressing diverse health challenges.
