Analytical Data
-
Gene name
RNASEH1
- Application
-
Alternative Names
RNASEH1；RNH1；Ribonuclease H1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60930
-
Expression Region
1-286aa
-
AA Sequence
MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQV DRFPAARFKKFATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRLR EPLDGDGHESAEPYAKHMKPSVEPAPPVSRDTFSYMGDFVVVYTDGCCSS NGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQ NINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERL TQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
-
Molecular Weight
59 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNASEH1, or Ribonuclease H1, is an essential enzyme that plays a crucial role in ribonucleic acid metabolism by specifically degrading RNA strands of RNA-DNA hybrids, thereby contributing to the maintenance of genomic stability and proper DNA replication. Research has highlighted its significance in various biological processes, including DNA repair, transcription regulation, and the resolution of R-loops, which are RNA-DNA hybrids that can impede transcription and lead to genomic instability. Mutations in the RNASEH1 gene have been implicated in several human diseases, particularly in neurodegenerative disorders and certain types of cancer, making it a potential target for therapeutic interventions. The recombinant expression of RNASEH1 is pivotal for understanding its structure-function relationships and biophysical properties, providing insights into its enzymatic mechanisms and interactions with nucleic acids. This knowledge could inform the development of inhibitors or modulators that may alter its activity for therapeutic purposes. Furthermore, studying this enzyme in a reconstituted system enhances our comprehension of RNA-DNA hybrid dynamics within the cell, offering valuable perspectives on nucleic acid processing pathways and their implications in disease states. Overall, RNASEH1's pivotal role in cellular processes and its association with pathologies underscores the importance of ongoing research into its functional mechanisms and potential applications in biotechnology and medicine.
