Analytical Data
-
Gene name
C16orf59
- Application
-
Alternative Names
TEDC2; C16orf59; Tubulin epsilon and delta complex Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L2K0
-
Expression Region
1-195aa
-
AA Sequence
MGARTPRPGAGLRDQQMAPSAAPQAPEAFTLKEKGHLLRLPAAFRKAASQNSSLWAQLSSTQTSDSTDAAAAKTQFLQNMQTASGGPQPRLSAVEVEAEAGRLRKACSLLRLRMREELSAAPMDWMQEYRCLLTLEGLQAMVGQCLHRLQELRAAPRSCRPWRPSSCEWLCWTSRSTWKRCFWKRRWGCNRGPQP
-
Molecular Weight
48.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C16orf59, also known as uncharacterized protein C16orf59, is a gene located on chromosome 16 that has garnered increasing interest in recent years due to its potential roles in various biological processes. Initially identified through genomic studies, the protein's exact functions remain largely unknown, making it a target for further investigation. Research has suggested that C16orf59 may be implicated in cellular functions such as proliferation, differentiation, and apoptosis, which are crucial for maintaining normal homeostasis. Moreover, its expression levels have been associated with certain pathological conditions, including various cancers, suggesting that C16orf59 could play a role in tumorigenesis or serve as a potential biomarker for disease progression. The recombinant expression of C16orf59 in suitable hosts is essential for understanding its structure and function, enabling researchers to study its interactions with other proteins and cellular components. As a result, the generation of C16orf59 recombinant protein has emerged as a key area of focus, providing insights into its biochemical properties and its potential implications in health and disease. The continued exploration of C16orf59 will contribute to a deeper understanding of its biological significance and offer new avenues for therapeutic interventions targeting related pathways.
