Analytical Data
-
Gene name
C16orf65
- Application
-
Alternative Names
PDZ domain-containing Protein 9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IXQ8
-
Expression Region
1-202aa
-
AA Sequence
MAEGEEEGGDVLISVGHANVLGYTLREFLQLLQHITIGTVLQIKVYRDFINIPEEWQEIYDLIPEAKFPVTSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISISRDWHGYKKKNHTISVGKDINCDVMIHRDDKKEVRAPSPYWIMVKQDNESSSSSTSSTSDAFWLEDCAQVEEGKAQLVSKVG
-
Molecular Weight
49.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C16orf65, also known as the "chromosome 16 open reading frame 65," has emerged as a significant subject of research due to its potential roles in cellular processes and disease mechanisms. Initially, the protein's function remained largely enigmatic, but studies have suggested its involvement in various biological functions, including cell proliferation, differentiation, and apoptosis. Recent advances in molecular biology techniques have facilitated the exploration of C16orf65's interactions within the cell, leading to the hypothesis that it may play a crucial role in the regulation of key signaling pathways. Furthermore, mutations or dysregulation of C16orf65 have been implicated in several diseases, particularly in cancer, where it may contribute to tumorigenesis. As researchers attempt to characterize this protein further, recombinant protein production has become an essential tool, allowing for detailed biochemical studies and functional assays. This has enabled the investigation of C16orf65's structure-function relationships and its potential as a biomarker or therapeutic target. The ongoing research into C16orf65 not only aims to elucidate its biological significance but also holds promise for advancing our understanding of related pathologies, potentially paving the way for novel therapeutic approaches.
