Analytical Data
-
Gene name
SFTA3
- Application
-
Alternative Names
SFTA3；SFTPH；Surfactant-associated Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C7M3
-
Expression Region
1-94aa
-
AA Sequence
MRAGFSDFQLIRDQVLFLQDQAQRLTEWLQLSGFENPVSESTTLCLRERE KRIPTCVAVCVPSPGTVHTALLHPTTLSQSRSSSEAKMLIIHTA
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFTA3, or Surfactant Protein A3, is a member of the surfactant protein family, which plays a crucial role in pulmonary surfactant function and innate immunity in the lungs. Research into SFTA3 has gained momentum due to its potential implications in respiratory diseases, including pulmonary fibrosis, asthma, and various infections. The protein is expressed in the alveolar epithelium and is pivotal for maintaining alveolar stability, host defense, and inflammatory responses. Understanding the structure and function of SFTA3 at the molecular level is essential for elucidating its role in lung physiology and pathophysiology. Recent studies have focused on the recombinant expression of SFTA3 to facilitate detailed functional analyses and explore its potential as a therapeutic target. By using techniques such as molecular cloning and expression in heterologous systems, researchers aim to produce SFTA3 in sufficient quantities for biochemical and biophysical characterization. Additionally, investigations into the binding properties of SFTA3 with pathogens, lipids, and other proteins enhance our knowledge of its multi-faceted roles in the lung environment. Overall, the research on SFTA3 not only contributes to our understanding of respiratory biology but also opens avenues for developing novel strategies for treating lung diseases.
