Analytical Data
-
Gene name
PSEN2
- Application
-
Alternative Names
AD3L; AD3LP; AD4; AD5; Alzheimer disease 4; CMD1V; E5-1; OTTHUMP00000035671; OTTHUMP00000035672; OTTHUMP00000228286; OTTHUMP00000228288; Presenilin 2 (Alzheimer disease 4); Presenilin 2; Presenilin-2 CTF subunit; PS-2; PS2; Psen2; PSN2_HUMAN; PSNL2; STM-2; STM2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49810
-
Expression Region
1-86 aa
-
AA Sequence
MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAK
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSEN2, or presenilin-2, is a vital component of the gamma-secretase complex, which plays a crucial role in the proteolytic processing of amyloid precursor protein (APP) and other type I transmembrane proteins. Mutations in the PSEN2 gene are associated with familial Alzheimer's disease (FAD), making it an important target for research into neurodegenerative disorders. The study of PSEN2 recombinant proteins has gained prominence as researchers seek to understand the molecular mechanisms underlying Alzheimer’s disease progression. These recombinant proteins allow for in-depth investigations into how mutations affect gamma-secretase activity, substrate specificity, and ultimately, amyloid-beta peptide generation. Enhanced knowledge of PSEN2's structure and function through recombinant technologies can reveal potential therapeutic targets, paving the way for novel interventions aimed at mitigating the severity and onset of Alzheimer’s disease. Additionally, understanding PSEN2's interactions with other proteins in the signaling pathways may contribute to a broader comprehension of its role in neuronal health and disease. Overall, the study of PSEN2 recombinant proteins is critical for advancing our understanding of Alzheimer’s disease pathology and developing effective treatments.
