Analytical Data
-
Gene name
SIRPD
- Application
-
Alternative Names
SIRPD;PTPNS1L2;Signal-regulatory Protein delta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H106
-
Expression Region
30-197aa
-
AA Sequence
FHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSK
-
Molecular Weight
34.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The SIRPD (SIRP alpha family member D) protein is a member of the Signal Regulatory Protein (SIRP) family, which is known to play a pivotal role in mediating immune responses, particularly in the regulation of macrophage activity and the interaction between immune cells and tumor cells. Research into SIRPD has gained momentum due to its potential implications in cancer immunotherapy and autoimmune diseases. SIRPD's primary function involves the binding to the receptor CD47, often referred to as the "don't eat me" signal, which inhibits phagocytosis by macrophages. Therefore, understanding SIRPD's molecular structure and its interactions can provide insights into the modulation of immune responses, leading to innovative therapeutic strategies that enhance anti-tumor immunity. Furthermore, as the role of SIRPD in various biological processes continues to be elucidated, its potential as a biomarker for disease progression and as a therapeutic target is being explored, warranting further research into its recombinant protein forms. These studies aim to characterize the protein's functional properties and its potential applications in designing new immunotherapeutic approaches, highlighting SIRPD's significance in the broader landscape of immunology and cancer research.











