Analytical Data
-
Gene name
APOA1
- Application
-
Alternative Names
APOA1；ApolipoProtein A-I
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02647
-
Expression Region
1-267aa
-
AA Sequence
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Apolipoprotein A-I (APOA1) is a key protein component of high-density lipoprotein (HDL) and plays a crucial role in lipid metabolism and cholesterol transport. It is primarily produced in the liver and intestines and is essential for reverse cholesterol transport, which helps to remove excess cholesterol from peripheral tissues back to the liver for excretion. The significance of APOA1 in cardiovascular health has garnered considerable attention, as lower levels of this protein are associated with an increased risk of atherosclerosis and related cardiovascular diseases. Researchers have focused on the functional properties of recombinant APOA1 (rAPOA1) as it presents opportunities for therapeutic interventions. By studying rAPOA1, scientists aim to understand its structure-function relationships, investigate its interaction with lipids, and explore its potential as a biomarker for cardiovascular diseases. Additionally, rAPOA1 is being evaluated for its role in drug delivery systems and as a therapeutic agent for dyslipidemia. Current studies involve the development of rAPOA1-based therapies that could improve HDL functionality, thereby offering innovative approaches to reduce cardiovascular risk and improve metabolic health. This ongoing research underscores the importance of APOA1 in maintaining lipid homeostasis and its potential as a target in the prevention and treatment of cardiovascular diseases.
