Analytical Data
-
Gene name
CUTC
- Application
-
Alternative Names
CUTC；Copper homeostasis Protein cutC homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NTM9
-
Expression Region
1-273aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKRQGASSERKRARIPSGKAGAANGFLMEV CVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFV MIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELC MSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE GLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRD SGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CUTC (C-terminal ubiquitin-like domain containing) proteins have emerged as a significant focus in the field of molecular biology due to their intriguing roles in various cellular processes. Originally identified in studies related to ubiquitination, these proteins are characterized by the presence of a ubiquitin-like domain, which suggests potential involvement in protein stability, signaling pathways, and cellular responses to stress. Researchers are particularly interested in CUTC proteins because of their regulatory functions in modulating protein interactions and degradation, which are crucial for maintaining cellular homeostasis. Furthermore, abnormalities in CUTC protein expression have been implicated in various diseases, including cancers and neurodegenerative disorders, highlighting their potential as therapeutic targets. The study of CUTC recombinant proteins aims to elucidate their mechanisms of action, interactions with other cellular components, and their influence on key biological pathways. By exploring these aspects, scientists hope to develop novel strategies for manipulating CUTC functions, which could lead to innovative treatments for diseases linked to their dysregulation. The use of recombinant DNA technology to produce CUTC proteins in vitro also paves the way for advanced biochemical and biophysical studies, enabling a deeper understanding of their roles in health and disease.
