Cat: PA2000-2208

Recombinant Human SFTPC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SFTPC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SFTPC;SFTP2;Surfactant Protein C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11686

  • Expression Region

    24-58aa

  • AA Sequence

    FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

  • Molecular Weight

    5.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SFTPC, or Surfactant Protein C, is a key component of pulmonary surfactant, a mixture of lipids and proteins that reduces surface tension in the alveoli and plays a crucial role in lung function and host defense. Mutations in the SFTPC gene have been linked to various lung diseases, particularly surfactant dysfunction disorders such as interstitial lung diseases and surfactant metabolism disorders. Given its critical role in maintaining pulmonary health, there is growing interest in studying SFTPC as a therapeutic target and diagnostic marker. Research has focused on recombinant SFTPC proteins, which can be produced through genetic engineering techniques, enabling the exploration of their structure, function, and potential applications in treating lung diseases. By investigating the biophysical properties and interactions of recombinant SFTPC with lipids and other surfactant proteins, researchers aim to understand the mechanisms underlying surfactant metabolism and its implications for disease. Moreover, recombinant SFTPC has potential therapeutic applications in the development of novel surfactant replacement therapies for treating surfactant deficiency in neonates and adults. Additionally, understanding the kinetics of recombinant SFTPC can contribute to the design of targeted therapies for lung diseases associated with SFTPC mutations, opening new avenues for therapeutic interventions. Overall, the study of recombinant SFTPC proteins is a rapidly evolving field that combines molecular biology, biochemistry, and clinical research to address significant health challenges related to lung function and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US