Analytical Data
-
Gene name
C5a
- Application
-
Alternative Names
C5a；ATP10C；ATPVA；ATPVC；Phospholipid-transporting ATPase VA
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01031
-
Expression Region
679-751aa
-
AA Sequence
LQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAF TECCVVASQLRANISHKDMQLGR
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C5a is a crucial complement component involved in the immune response, known for its role in promoting inflammation and recruiting immune cells to sites of infection or injury. As a part of the complement system, C5a is generated during the activation of complement pathways and serves as a potent anaphylatoxin. Its biological activities include enhancing vascular permeability, stimulating the release of pro-inflammatory cytokines, and activating various immune cell types such as neutrophils, monocytes, and mast cells. Research has shown that dysregulation of C5a and its receptor, C5aR1, is implicated in various pathological conditions, including sepsis, autoimmune diseases, and chronic inflammatory disorders. To better understand C5a’s role and therapeutic potential, scientists have focused on the development of recombinant C5a proteins. These recombinant proteins allow for detailed studies of C5a’s structure-function relationships, receptor interactions, and downstream signaling pathways. By utilizing recombinant technology, researchers aim to investigate the potential of C5a as a target for novel therapeutic interventions, exploring the possibility of C5a inhibitors to modulate excessive inflammatory responses in disease contexts. Additionally, understanding the precise mechanisms by which C5a mediates immune responses could inform vaccine development and strategies to harness the complement system for enhanced immunity against infections. Overall, the study of recombinant C5a proteins represents a significant advance in immunology and holds promise for novel therapeutic applications that could improve outcomes in inflammatory and autoimmune diseases.
