Analytical Data
-
Gene name
C17orf37
- Application
-
Alternative Names
C17orf37 homolog; C35; chromosome 17 open reading frame 37 ; HBV X transactivated gene 4 Protein; HBV X-transactivated gene 4 Protein; HBV XAg transactivated Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRT3
-
Expression Region
1-115aa
-
AA Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
-
Molecular Weight
38.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C17orf37, also known as C17orf37 gene, encodes a protein of unknown function that has garnered attention in recent years due to its potential implications in various diseases, including cancer and neurodegenerative disorders. This gene maps to chromosome 17 and is thought to play a role in cellular processes such as cell proliferation and apoptosis. Studies have indicated that alterations in C17orf37 expression may be associated with tumorigenesis, suggesting it could serve as a biomarker for certain malignancies. Furthermore, its involvement in cellular stress responses and potential interactions with key signaling pathways highlight the significance of understanding its biological role. The recombinant protein derived from C17orf37 offers a promising avenue for investigating its functional properties and elucidating its mechanisms of action. By producing and characterizing this protein, researchers aim to explore its interactions with other cellular components, which may unveil novel therapeutic targets. Additionally, the development of antibodies against C17orf37 could facilitate studies on its localization and expression patterns in various tissues, further clarifying its potential roles in health and disease. Overall, the study of C17orf37 recombinant protein represents a critical step towards delineating the biological significance of this enigmatic gene and its potential contributions to disease pathogenesis.
