Analytical Data
-
Gene name
LTP2
- Application
-
Alternative Names
LTP2；17-hydroxy-3-oxo-4-pregnene-20-carboxyl-CoA lyase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55958
-
Expression Region
32-133aa
-
AA Sequence
EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
-
Molecular Weight
27.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LTP2 (Lipid Transfer Protein 2) is a small, cysteine-rich protein that belongs to the pathogenesis-related protein (PR) family, primarily found in plants. It plays a crucial role in lipid transport, which is essential for various physiological processes, including membrane formation, seed germination, and plant defense mechanisms against pathogens. Given its pivotal function in maintaining cellular homeostasis, research into LTP2 has garnered significant interest, particularly concerning its potential applications in agriculture and biotechnology. Several studies have demonstrated that LTP2 can enhance resistance to various biotic and abiotic stresses, making it a candidate for engineering stress-tolerant crops. Additionally, its ability to interact with lipids has implications for understanding plant-microbe interactions and the plant immune response. Advances in molecular biology and genetic engineering have facilitated the characterization and manipulation of LTP2 in various plant systems, further underscoring its importance in plant resilience. As climate change poses increasing challenges to crop production, the exploration of LTP2's functional roles offers promising prospects for developing innovative strategies to enhance plant stress tolerance and improve agricultural sustainability. The ongoing research into LTP2 not only provides insights into fundamental plant biology but also holds potential for practical applications in crop improvement and food security.
