Analytical Data
-
Gene name
vacA
- Application
-
Alternative Names
vacA;AF3P21;SPIN90;NCK-interacting Protein with SH3 domain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55981
-
Expression Region
37-245aa
-
AA Sequence
TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQA GKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDM KDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTT RVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEI SLYDGATLN
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of vacA recombinant protein centers on understanding the virulence factors associated with Helicobacter pylori, a bacterium implicated in gastric diseases, including peptic ulcers and gastric cancer. The vacA gene encodes a vacuolating cytotoxin that plays a crucial role in the pathogenicity of H. pylori. Research has demonstrated that the VacA protein can induce vacuole formation in host cells, disrupt cellular signaling pathways, and modulate immune responses, contributing to the bacterium's ability to survive in the harsh acidic environment of the stomach. Given the public health significance of H. pylori infections, the exploration of vacA recombinant protein holds promise for developing novel diagnostic tools, therapeutic strategies, and vaccines. By producing and characterizing recombinant forms of VacA, scientists aim to elucidate the structure-function relationships of the protein, its interaction with host cells, and the underlying mechanisms of its cytotoxic effects. Understanding these aspects may pave the way for targeted interventions against H. pylori and reduce the burden of associated diseases, making vacA a critical focus in microbiological and biomedical research.











