Cat: PA2000-2698

Recombinant Human vacA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    vacA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    vacA;AF3P21;SPIN90;NCK-interacting Protein with SH3 domain

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55981

  • Expression Region

    37-245aa

  • AA Sequence

    TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQA GKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDM KDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTT RVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEI SLYDGATLN

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of vacA recombinant protein centers on understanding the virulence factors associated with Helicobacter pylori, a bacterium implicated in gastric diseases, including peptic ulcers and gastric cancer. The vacA gene encodes a vacuolating cytotoxin that plays a crucial role in the pathogenicity of H. pylori. Research has demonstrated that the VacA protein can induce vacuole formation in host cells, disrupt cellular signaling pathways, and modulate immune responses, contributing to the bacterium's ability to survive in the harsh acidic environment of the stomach. Given the public health significance of H. pylori infections, the exploration of vacA recombinant protein holds promise for developing novel diagnostic tools, therapeutic strategies, and vaccines. By producing and characterizing recombinant forms of VacA, scientists aim to elucidate the structure-function relationships of the protein, its interaction with host cells, and the underlying mechanisms of its cytotoxic effects. Understanding these aspects may pave the way for targeted interventions against H. pylori and reduce the burden of associated diseases, making vacA a critical focus in microbiological and biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US