Analytical Data
-
Gene name
CHAC1
- Application
-
Alternative Names
Blocks Notch Protein; Botch; Cation transport regulator like Protein 1; Cation transport regulator-like Protein 1; ChaC; ChaC cation transport regulator homolog 1; ChaC cation transport regulator like 1; chac1; CHAC1_HUMAN; Gamma GCT acting on glutathione homolog 1; Gamma-GCG 1; Glutathione-specific gamma-glutamylcyclotransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BUX1
-
Expression Region
1-222aa
-
AA Sequence
MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
-
Molecular Weight
24.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHAC1, or Channel Catfish Apoptosis-Related Protein 1, is a key player in cellular response to stress and apoptosis regulation. Initially identified in channel catfish, this protein has attracted attention due to its significant role in various physiological processes, including immune response and cellular signaling pathways. Research has shown that CHAC1 can influence the apoptotic mechanisms by modulating the mitochondrial pathway and interacting with various cellular factors. Moreover, studies suggest that CHAC1 may be involved in the modulation of reactive oxygen species (ROS) levels, affecting cell survival and proliferation. The understanding of CHAC1's function is crucial, as it has potential implications in cancer research, highlighting its dual role as a pro-apoptotic factor. Recent advancements in recombinant protein technology have enabled the production of CHAC1 in a laboratory setting, facilitating in-depth functional studies. This availability paves the way for further exploration of CHAC1 as a therapeutic target in diseases characterized by dysregulated apoptosis, making it a promising candidate for novel treatment strategies. Overall, CHAC1 research contributes significantly to our understanding of apoptosis and its regulation, providing insights into potential interventions for various diseases.
