Analytical Data
-
Gene name
CKMT1B
- Application
-
Alternative Names
CKMT; CKMT1; CKMT1B; Creatine kinase mitochondrial 1 (ubiquitous); Creatine kinase mitochondrial 1B; Creatine kinase U type mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12532
-
Expression Region
40-417aa
-
AA Sequence
ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
-
Molecular Weight
47.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CKMT1B, or creatine kinase mitochondrial 1B, is a critical enzyme involved in cellular energy metabolism, particularly within the mitochondria, where it plays a crucial role in maintaining ATP levels and facilitating the transport of creatine and phosphocreatine. Research on CKMT1B has garnered significant interest due to its implications in muscle function, neuroprotection, and various pathological conditions, including mitochondrial diseases and neurodegenerative disorders like Parkinson's and Alzheimer's. The expression and activity of CKMT1B can be influenced by factors such as oxidative stress and metabolic dysregulation, making it a potential biomarker and therapeutic target. Recombinant CKMT1B protein studies enable detailed investigations into its structural and functional properties, elucidating mechanisms of action and interactions within the mitochondrial environment. Additionally, the ability to produce recombinant CKMT1B protein facilitates high-throughput screening of potential drug candidates that could modulate its activity, offering promising avenues for developing treatments for related disorders. Overall, the research surrounding CKMT1B not only enhances our understanding of mitochondrial biology but also opens up new possibilities for therapeutic interventions in energy metabolism-related diseases.
