Analytical Data
-
Gene name
CMAH
- Application
-
Alternative Names
Inactive cytidine monophosphate-N-acetylneuraminic acid hydroxylase. CMP-NeuAc hydroxylase-like protein. Cytidine monophosphate-N-acetylneuraminic acid hydroxylase pseudogene
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y471
-
Expression Region
385-485aa
-
AA Sequence
GYDYLVDFLDLSFPKERPQREHPYEEIHSRVDVIRHVVKNGLLWDELYIGFQTRLQRDPDIYHHLFWNHFQIKLPLTPPNWKSFLMCCEQNGPAILQECKT
-
Molecular Weight
36.85 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of CMAH (cytidine monophosphate N-acetylneuraminic acid hydroxylase) recombinant proteins has gained considerable attention due to their potential applications in various fields, including biotechnology, medicine, and genetics. CMAH is an enzyme responsible for converting CMP-N-acetylneuraminic acid (CMP-Neu5Ac) into CMP-sialic acid (CMP-Neu5Gc), a significant step in glycan biosynthesis. Alterations in CMAH activity have implications for human health, particularly concerning immune responses and potential cancer progression. In humans, a mutation in the CMAH gene has rendered the synthesis of Neu5Gc non-functional, which raises questions about evolutionary adaptations and the role of sialic acids in cell signaling and pathogen recognition. The recombinant expression of CMAH can help clarify its functional mechanisms and the biochemical pathways involved in sialic acid metabolism. Furthermore, producing CMAH in a controlled environment allows researchers to explore its structural properties, enzymatic activity, and interactions with specific substrates. This knowledge could lead to innovative therapeutic strategies, such as designing vaccines or studying autoimmune diseases, where sialic acid modification plays a crucial role. Additionally, understanding CMAH's function and regulation could provide insights into evolutionary biology by examining the implications of the CMAH gene mutation in humans versus other mammals. As research progresses, the development of CMAH recombinant proteins will likely open new avenues for research into glycoprotein engineering, enhancing our understanding of complex biological processes and their impact on health and disease.
