Analytical Data
-
Gene name
SLMAP
- Application
-
Alternative Names
SLMAP; KIAA1601; SLAP; UNQ1847/PRO3577; Sarcolemmal membrane-associated protein; Sarcolemmal-associated protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14BN4
-
Expression Region
677-784 aa
-
AA Sequence
LHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPW
-
Molecular Weight
37.62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLMAP (Skeletal Muscle and Heart-specific Lymphocyte Antigen 1) is a protein that has garnered attention in recent years due to its potential roles in muscle biology and its implications in various cardiovascular diseases. Originally identified in skeletal muscle and heart tissues, SLMAP is involved in muscle development and regeneration, as well as the maintenance of cardiac function. The research background surrounding SLMAP highlights its significance as a member of the muscle-specific protein family, which affects myofibril organization and cellular signaling pathways. Studies have suggested that alterations in SLMAP expression may be linked to conditions such as muscular dystrophy, heart failure, and other myopathies. Given the rising prevalence of such disorders globally, understanding the molecular mechanisms governed by SLMAP could pave the way for novel therapeutic strategies. Recent advancements in recombinant protein technology have facilitated detailed investigations of SLMAP’s structure and function, enabling researchers to study its interactions with other cellular components and to elucidate its role in disease pathogenesis. As a result, SLMAP is not only a crucial biomarker for muscle and heart health but also a promising target for drug development and regenerative medicine.
