Cat: PAX2000-11497

Recombinant Human SLMAP Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLMAP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLMAP; KIAA1601; SLAP; UNQ1847/PRO3577; Sarcolemmal membrane-associated protein; Sarcolemmal-associated protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14BN4

  • Expression Region

    677-784  aa

  • AA Sequence

    LHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPW

  • Molecular Weight

    37.62 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLMAP (Skeletal Muscle and Heart-specific Lymphocyte Antigen 1) is a protein that has garnered attention in recent years due to its potential roles in muscle biology and its implications in various cardiovascular diseases. Originally identified in skeletal muscle and heart tissues, SLMAP is involved in muscle development and regeneration, as well as the maintenance of cardiac function. The research background surrounding SLMAP highlights its significance as a member of the muscle-specific protein family, which affects myofibril organization and cellular signaling pathways. Studies have suggested that alterations in SLMAP expression may be linked to conditions such as muscular dystrophy, heart failure, and other myopathies. Given the rising prevalence of such disorders globally, understanding the molecular mechanisms governed by SLMAP could pave the way for novel therapeutic strategies. Recent advancements in recombinant protein technology have facilitated detailed investigations of SLMAP’s structure and function, enabling researchers to study its interactions with other cellular components and to elucidate its role in disease pathogenesis. As a result, SLMAP is not only a crucial biomarker for muscle and heart health but also a promising target for drug development and regenerative medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US