Analytical Data
-
Gene name
TIMM21
- Application
-
Alternative Names
TIMM21；C18orf55；TIM21；Mitochondrial import inner membrane translocase subunit Tim21
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BVV7
-
Expression Region
1-248aa
-
AA Sequence
MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD
-
Molecular Weight
55.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIMM21, a crucial component of the mitochondrial translocase complex, plays an essential role in the import of nuclear-encoded proteins into mitochondria. This protein is vital for mitochondrial function, which is integral to cellular energy metabolism and overall cell health. Abnormalities in TIMM21 have been linked to various mitochondrial disorders and diseases, making it a significant target for research in cellular biology and medical science. Studies have shown that TIMM21 facilitates the proper folding and insertion of proteins into the inner mitochondrial membrane, directly influencing mitochondrial biogenesis and function. Furthermore, TIMM21 interacts with other translocase components, underscoring its importance in maintaining mitochondrial integrity. Research efforts have focused on characterizing the structure and function of TIMM21, investigating its role in pathophysiology, and exploring its potential as a therapeutic target. By understanding TIMM21's function in mitochondrial import pathways, scientists aim to develop strategies to address mitochondrial-related diseases, highlighting the protein's relevance in both fundamental and applied biomedical research. This ongoing investigation not only elucidates the intricate mechanisms of mitochondrial protein transport but also holds promise for novel therapeutic approaches in the treatment of mitochondrial dysfunction.
