Analytical Data
-
Gene name
DEADC1
- Application
-
Alternative Names
DAT2_HUMAN; Adenosine deaminase tRNA specific 2; Adenosine deaminase tRNA specific 2 TAD2 homolog; DEADC1; Deaminase domain containing 1; Deaminase domain containing protein 1; Deaminase domain-containing protein 1; dJ20N2; dJ20N2.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z6V5
-
Expression Region
1-144aa
-
AA Sequence
MVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
-
Molecular Weight
42.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DECR2 (2,4-dienoyl-CoA reductase 2) is a crucial enzyme involved in the metabolism of unsaturated fatty acids, particularly in the process of beta-oxidation within mitochondria. The study of DECR2 has gained significance due to its role in various metabolic disorders and its potential implications in health and disease. Mutations in the gene encoding DECR2 can lead to a rare condition known as mitochondrial acyl-CoA dehydrogenase deficiency, which manifests as neurological issues, muscle weakness, and other systemic complications. Understanding DECR2's structure and function is essential for elucidating the metabolic pathways it participates in and can provide insights into targeted therapeutic approaches for related diseases. Moreover, given the rising interest in metabolic health and its links to obesity, diabetes, and cardiovascular disease, DECR2 has emerged as a promising target for research aimed at enhancing metabolic efficiency and developing new treatments. The recombinant production of DECR2 allows detailed studies of its enzymatic properties, interactions, and potential roles in cellular metabolism, paving the way for innovative strategies to manipulate fatty acid metabolism for therapeutic benefits.
