Analytical Data
-
Gene name
ASAH1
- Application
-
Alternative Names
ASAH1；ASAH；Acid ceramidase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13510
-
Expression Region
25-124aa
-
AA Sequence
PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLK VIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ASAH1 gene encodes a lysosomal enzyme known as acid ceramidase, which plays a crucial role in the sphingolipid metabolism pathway. This enzyme is responsible for the hydrolysis of ceramide to sphingosine and free fatty acids, processes that are essential for maintaining cellular homeostasis and regulating various cellular functions, including apoptosis, cell proliferation, and inflammatory responses. Mutations in the ASAH1 gene have been linked to specific lysosomal storage disorders, such as Farber's disease, characterized by the accumulation of ceramide in tissues, leading to debilitating symptoms that significantly affect quality of life. Research on recombinant ASAH1 protein focuses on understanding the molecular mechanisms underlying its enzymatic activity, exploring potential therapeutic applications for treating ASAH1-related disorders, and developing gene therapy or enzyme replacement strategies. The overexpression and purification of recombinant ASAH1 protein facilitate biochemical studies and the evaluation of small molecule inhibitors or activators, which can ultimately lead to novel therapeutic interventions. Additionally, ongoing studies aim to elucidate the regulatory pathways involved in ASAH1 expression and function, which could provide deeper insights into its role in various diseases, including neurodegenerative conditions. Understanding the biological significance of ASAH1 is fundamental for developing targeted therapies and improving outcomes for affected patients, making it a significant focus in biomedical research.
