Analytical Data
-
Gene name
SSR3
- Application
-
Alternative Names
SSR3; TRAPG; Translocon-associated Protein subunit gamma; TRAP-gamma; Signal sequence receptor subunit gamma; SSR-gamma
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UNL2
-
Expression Region
1-185 aa
-
AA Sequence
MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYRRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK
-
Molecular Weight
46.09 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SSR3, or Signal Sequence Repeats 3, is a protein that has garnered attention within the field of molecular biology due to its potential role in various cellular processes and its involvement in diseases. Initially identified as part of the signal recognition particle (SRP) pathway, SSR3 is known to facilitate the co-translational translocation of proteins into the endoplasmic reticulum (ER). Research into SSR3 has revealed its significance in maintaining protein homeostasis, as well as its involvement in the stress response mechanisms within the ER. Dysfunctions in SSR3 expression or function have been linked to several pathological conditions, including cancers and neurodegenerative diseases, making it a target of interest for therapeutic interventions. Recent studies have focused on characterizing the structure and function of SSR3 using recombinant protein techniques to elucidate its mechanisms of action, interactions with other cellular components, and potential as a biomarker for disease. Understanding the role of SSR3 in the cellular context is crucial for developing novel strategies aimed at modulating its expression or activity to combat diseases associated with ER stress and protein misfolding. Overall, research on SSR3 and its recombinant forms has the potential to pave the way for advancements in targeted therapies and enhance our understanding of cellular stress responses.
