Analytical Data
-
Gene name
HES1
- Application
-
Alternative Names
HES1；BHLHB39；HL；HRY；Transcription factor HES-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14469
-
Expression Region
36-142aa
-
AA Sequence
KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTV KHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEV RTRLLGH
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HES1, a basic helix-loop-helix transcription factor, plays a crucial role in the Notch signaling pathway, which is vital for various developmental processes and cell fate determination. It has been implicated in the regulation of stem cell maintenance, differentiation, and the proliferation of progenitor cells. Dysregulation of HES1 has been associated with several pathological conditions, including cancer and neurodegenerative diseases. The production of recombinant HES1 protein has become essential for elucidating its functional mechanisms and therapeutic potential. Researchers have developed various methods to produce HES1 recombinantly, allowing for detailed studies of its interactions with other proteins and its effects on gene expression. Understanding the structure and function of HES1 at a molecular level may lead to novel strategies in regenerative medicine and cancer therapy. By exploring its roles in cellular processes, researchers aim to unveil new therapeutic targets that could mitigate the adverse effects of diseases linked to HES1 dysregulation. Thus, the study of HES1 recombinant protein is significant for both basic and applied biomedical research.
