Analytical Data
-
Gene name
TAF12
- Application
-
Alternative Names
TAF12；TAF15；TAF2J；TAFII20；Transcription initiation factor TFIID subunit 12
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16514
-
Expression Region
1-161aa
-
AA Sequence
MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
-
Molecular Weight
33.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAF12 (TATA-box binding protein associated factor 12) is a crucial component of the transcriptional machinery in eukaryotic cells, playing a pivotal role in the regulation of gene expression. Initially identified as part of the TFIID complex, TAF12 is involved in the binding of transcription factors to the core promoter, assisting in the assembly of the pre-initiation complex necessary for RNA polymerase II-mediated transcription. Recent studies have highlighted its significance in various cellular processes, including cell differentiation, development, and response to stress. Given its essential functions, TAF12 has garnered attention as a potential therapeutic target in cancer and other diseases where aberrant transcriptional regulation plays a role. The production of recombinant TAF12 protein allows for detailed structure-function studies, enabling researchers to investigate its interactions with other transcriptional components and elucidate its regulatory mechanisms. This research is not only vital for understanding fundamental cellular processes but also for developing novel strategies to manipulate gene expression in therapeutic contexts.
