Analytical Data
-
Gene name
ST18
- Application
-
Alternative Names
Zinc finger Protein 387
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60284
-
Expression Region
120-260 aa
-
AA Sequence
SCYQELMVKSLMHLGKFEKNVSVQTVSENLNDSGIQSLKAESDEADECFLIHSDDGRDKIDDSQPPFCSSDDNESNSESAENGWDSGSNFSEETKPPRVPKYVLTDHKKDLLEVPEIKTEGDKFIPCENRCDSETERKDPQ
-
Molecular Weight
23.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ST18 is a gene that encodes a protein with potential roles in cellular stress response, apoptosis, and tumor progression, making it a subject of interest in cancer research. Recent studies have suggested that ST18 may act as a tumor suppressor in various malignancies by regulating pathways associated with cell survival and proliferation. Its expression levels have been linked to specific cancer types, indicating that ST18 might influence tumor characteristics and patient prognosis. Given the increase in cancer incidence globally, understanding the functional mechanisms of ST18 and the implications of its protein product could provide valuable insights into novel therapeutic strategies. Researchers are focusing on characterizing the ST18 recombinant protein to elucidate its functional properties, interactions with other cellular proteins, and regulatory mechanisms. These studies aim to establish a comprehensive understanding of ST18’s role in cellular pathways, which could ultimately contribute to the development of targeted therapies that leverage the protein's function in combating cancer. The characterization of ST18 and its associated pathways may also promote the discovery of biomarkers for early detection and treatment response, thereby enhancing clinical outcomes for cancer patients.
