Analytical Data
-
Gene name
TMEM184B
- Application
-
Alternative Names
TMEM184B; C22orf5; PSEC0108; Transmembrane Protein 184B; Putative MAPK-activating Protein FM08
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y519
-
Expression Region
1-407 aa
-
AA Sequence
MTVRGDVLAPDPASPTTAAASPSVSVIPEGSPTAMEQPVFLMTTAAQAISGFFVWTALLITCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEALVIYNFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIGFLRFCKQATLQFCVVKPLMAVSTVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHSARVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF
-
Molecular Weight
71.17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM184B is a member of the transmembrane protein family that has gained attention due to its potential role in various biological processes, including cell signaling, membrane dynamics, and disease pathology. Research has indicated that TMEM184B may be involved in immune responses and cancer development, making it a target of interest for therapeutic interventions. Despite its significance, the functional mechanisms of TMEM184B remain largely unexplored. Recent studies have focused on the recombinant expression of TMEM184B to better understand its structure and biological functions, facilitating the exploration of its interactions with other proteins and cellular pathways. Recombinant TMEM184B proteins enable high-throughput assays and structural studies, providing insights into its possible roles in pathophysiological conditions. By elucidating the functional characteristics of TMEM184B, researchers aim to pave the way for potential clinical applications, including targeted therapies and biomarker development in diseases where TMEM184B is implicated. Thus, understanding the biology of TMEM184B through recombinant protein studies is crucial for advancing knowledge in cell biology and developing innovative treatment strategies.
