Analytical Data
-
Gene name
TOP2A
- Application
-
Alternative Names
alpha isozyme; ATP hydrolyzing DNA topoisomerase II alfa; DNA gyrase; DNA topoisomerase (ATP hydrolyzing); DNA topoisomerase 2 alpha; DNA topoisomerase 2-alpha; DNA topoisomerase II 170 kD; DNA topoisomerase II alpha isozyme; DNA topoisomerase II; DNA Topoisomerase2; TOP 2A; TOP2; TOP2A; TOP2A_HUMAN; Topoisomerase DNA II alpha 170kDa; TP2A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11388
-
Expression Region
1435-1531 aa
-
AA Sequence
RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
-
Molecular Weight
36.41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TOP2A, or Topoisomerase II Alpha, is a crucial enzyme that plays a significant role in DNA replication, repair, and chromatin organization. It is essential for resolving DNA supercoiling and tangling during cell division, thus ensuring proper segregation of chromosomes. Abnormal expression or activity of TOP2A has been implicated in various cancers, making it a potential therapeutic target. Recent studies have investigated TOP2A as a biomarker for predicting treatment responses in cancers, particularly in combination therapies involving chemotherapeutic agents. The enzyme's dual role in maintaining genomic stability while also being a target for DNA-damaging agents has sparked intense research into its structure and function. Given its importance in mitotic and meiotic processes, scientists have focused on characterizing recombinant TOP2A proteins to elucidate their structural and functional properties. This has led to advances in understanding how mutations or post-translational modifications affect its activity, ultimately informing drug development strategies aimed at enhancing the effectiveness of cancer therapies. As researchers continue to explore the intricacies of TOP2A, its potential as a target for targeted therapies remains a significant area of focus, particularly in tailoring personalized medicine approaches for patients with TOP2A-related malignancies. Overall, the study of recombinant TOP2A proteins promises to deepen our understanding of cellular processes and pave the way for innovative therapeutic interventions in cancer treatment.
