Analytical Data
-
Gene name
FAM101B
- Application
-
Alternative Names
RFLNB; Refilin-B; Regulator of filamin protein B; RefilinB
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N5W9
-
Expression Region
1-214aa
-
AA Sequence
MVGRLSLQDVPELVDAKKKGDGVLDSPDSGLPPSPSPSHWGLAAGGGGGERAAAPGTLEPDAAAATPAAPSPASLPLAPGCALRLCPLSFGEGVEFDPLPPKEVRYTSLVKYDSERHFIDDVQLPLGLAVASCSQTVTCVPNGTWRNYKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTTTLDYNCRKTLRRFLSSVELEAAELPGSDDLSDEC
-
Molecular Weight
49.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM101B, a member of the FAM101 protein family, has garnered attention due to its involvement in various cellular processes and potential implications in human health. Recent studies suggest that FAM101B plays a crucial role in cellular signaling pathways, particularly those related to cell proliferation and apoptosis. Its expression is often differentially regulated in various tissues and under pathological conditions, indicating its significance in disease mechanisms. Notably, FAM101B has been linked to cancer progression, where altered expression levels may contribute to tumorigenesis and metastasis. The exploration of FAM101B as a recombinant protein has become pivotal in understanding its functional roles and interactions within cellular systems. Researchers are focused on expressing and purifying FAM101B to elucidate its structure-function relationships and identify potential therapeutic targets. As recombinant proteins allow for in-depth functional assays, the study of FAM101B could pave the way for novel strategies in cancer treatment and other diseases where its expression is implicated. The ongoing research into FAM101B not only enhances our understanding of its biological roles but also opens avenues for innovative therapeutic interventions.
