Analytical Data
-
Gene name
FBXL7
- Application
-
Alternative Names
FBXL7; FBL6; FBL7; KIAA0840F-box/LRR-repeat protein 7; F-box and leucine-rich repeat protein 7; F-box protein FBL6/FBL7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UJT9
-
Expression Region
1-491aa
-
AA Sequence
MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAFF
-
Molecular Weight
81 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXL7, a member of the F-box protein family, plays a crucial role in the ubiquitin-proteasome system, which regulates protein degradation and cell cycle progression. This protein is primarily involved in targeting specific substrates for ubiquitination, thereby marking them for proteasomal degradation. Recent studies have implicated FBXL7 in various cellular processes, including the regulation of cell proliferation, differentiation, and apoptosis. Dysregulation of FBXL7 has been associated with several diseases, including cancer, highlighting its potential as a biomarker for tumor progression and as a therapeutic target. Research has focused on elucidating the mechanisms by which FBXL7 identifies and interacts with its substrates, as well as understanding its role in signaling pathways, particularly those involved in cancer biology. The overexpression or underexpression of FBXL7 can influence the stability of key regulatory proteins, making it a pivotal component in maintaining cellular homeostasis. Given its importance in oncogenesis and cellular regulation, the study of FBXL7 and its recombinant protein forms provides valuable insights into its functional roles and offers prospects for developing novel therapeutic strategies aimed at modulating its activity in various diseases. Understanding FBXL7’s contributions to the molecular underpinnings of disease can pave the way for innovative interventions that target its dysregulation in pathological contexts.
