Analytical Data
-
Gene name
BMP10
- Application
-
Biological Activity
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 1.7-2.1 ng/mL.
-
Alternative Names
BMP10；Bone morphogenetic Protein 10
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His and GST Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95393
-
Expression Region
Arg315-Arg424
-
AA Sequence
RRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
-
Molecular Weight
42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
BMP10, or Bone Morphogenetic Protein 10, is a member of the BMP family, which plays critical roles in various physiological processes, including embryonic development, bone formation, and tissue regeneration. Identified for its unique signaling properties, BMP10 is primarily expressed in the heart, where it influences cardiovascular development and homeostasis. Research indicates that BMP10 is involved in the regulation of endothelial cell function and angiogenesis, making it a promising candidate for therapeutic applications in cardiovascular diseases. Additionally, its role in the regulation of gene expression related to embryonic stem cell differentiation has sparked interest in its potential implications for regenerative medicine. The recombinant protein form of BMP10 enables detailed studies of its biological functions and interactions. Generating BMP10 as a recombinant protein allows for controlled experiments to elucidate its mechanisms of action and explore its therapeutic benefits. Furthermore, the ability to engineer variations of BMP10 can provide insights into its functional domains and help develop targeted strategies for treating diseases related to vascular dysfunction and heart diseases. Through ongoing research, the exploration of BMP10's capabilities offers promising avenues for advancements in both basic science and clinical applications, positioning it as a significant focus in the field of molecular biology and translational medicine.
