Analytical Data
-
Gene name
SDHC
- Application
-
Alternative Names
SDHC；CYB560；SDH3；Succinate dehydrogenase cytochrome b560 subunit. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99643
-
Expression Region
1-169aa
-
AA Sequence
MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM
-
Molecular Weight
18.6 b kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SDHC (Succinate Dehydrogenase Complex Subunit C) is a crucial component of the mitochondrial respiratory chain and is involved in the conversion of succinate to fumarate in the citric acid cycle. Mutations in the SDHC gene have been linked to hereditary paragangliomas and pheochromocytomas, which are tumors arising from the neuroendocrine system. The study of recombinant SDHC proteins has garnered significant interest in recent years due to their role in understanding the pathophysiology of these tumors and their potential implications in cancer biology. By expressing and purifying SDHC as a recombinant protein, researchers can investigate its structural and functional properties, elucidate the mechanisms by which mutations affect its activity, and explore its interactions with other components of the succinate dehydrogenase complex. This research not only provides insight into the enzymatic function and regulation of SDHC but also aids in developing targeted therapies for patients with SDHC-related tumors. Additionally, understanding the biochemical pathways influenced by SDHC can reveal broader implications for metabolic disorders and tumor development, thereby highlighting the importance of continued exploration into the biology of this protein and its associated complexes in both health and disease.
