Cat: PA1000-8775

Recombinant Human TR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TR;CIP4;STOT;STP;Cdc42-interacting Protein 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8IYR6

  • Expression Region

    40-330aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSSNQPPGGGGGSGGDCPGGKGKSINCSE LNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGD TYQNECFLRRAACKHQKEITVIARGPCYSDNGSGSGEGEEEGSGAEVHRK HSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPCFV REASCIKQEQIDIRHLGHCTDTDDTSLLGKKDDGLQYRPDVKDASDQRED VYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTDFS ILYVVPSRQKLTHV

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TR (Tetratricopeptide Repeat) proteins are an important class of proteins characterized by the presence of tandem repeats of approximately 34 amino acids that form a helix-loop-helix structure. These proteins play crucial roles in various biological processes, including protein-protein interactions, molecular chaperoning, and signal transduction. The study of TR proteins has gained significant attention due to their involvement in critical cellular functions and their implications in various diseases. For instance, dysregulation of TR proteins has been linked to cancer, neurodegenerative disorders, and other pathologies, making them potential targets for therapeutic intervention. Research into TR protein structure and function utilizes a range of techniques, including crystallography, NMR spectroscopy, and advanced imaging methods, to elucidate their mechanisms of action. Additionally, the versatility of TR repeats as modular interaction motifs has opened avenues for engineering novel proteins with specific functionalities, enhancing their potential applications in biotechnology and medicine. As our understanding of TR proteins deepens, it continues to provide insights into fundamental biological processes and offers promising strategies for disease treatment and prevention.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US