Analytical Data
-
Gene name
FFAR2
- Application
-
Alternative Names
FFAR2；FFA2；GPCR43；GPR43；Free fatty acid receptor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15552
-
Expression Region
1-330aa
-
AA Sequence
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
-
Molecular Weight
37.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FFAR2 (Free Fatty Acid Receptor 2), also known as GPR43, is an important G protein-coupled receptor primarily expressed in immune cells, adipose tissue, and the gastrointestinal tract. Research into FFAR2 has gained momentum due to its role in regulating metabolic processes, inflammation, and immune responses. It is activated by short-chain fatty acids (SCFAs) such as acetate, propionate, and butyrate, which are produced during the fermentation of dietary fibers by gut microbiota. This interaction suggests that FFAR2 is a critical link between diet, gut microbiota, and health. Understanding the mechanisms through which FFAR2 functions could unveil potential therapeutic targets for metabolic disorders, obesity, and inflammatory diseases. Additionally, FFAR2's contribution to gut-brain communication highlights its relevance in neuroinflammation and neurodegenerative conditions. As researchers explore FFAR2 through recombinant protein studies, the aim is to elucidate its signaling pathways and physiological roles, with the hope of harnessing this receptor's potential to improve health outcomes linked to diet and chronic diseases.
