Cat: PA1000-8845

Recombinant Human ADAMTS1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADAMTS1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ADAMTS1;KIAA1346;METH1;A disintegrin and metalloProteinase with thrombospondin motifs 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UHI8

  • Expression Region

    253-616aa

  • AA Sequence

    FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSV SLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDT AILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHE LGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMIT SFLDNGHGECLMDKPHNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDA ASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRK HFDTPFHGNWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKR VRYRSCNLEDCPDN(H)6

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADAMTS1 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 1) is a member of the ADAMTS family, which plays critical roles in extracellular matrix (ECM) remodeling and is implicated in various physiological and pathological processes. It is primarily involved in the cleavage of aggrecan, a major component of cartilage, and has been associated with the regulation of angiogenesis and tumor progression. Studies have shown that ADAMTS1 expression is modulated in various diseases, including cancer, where it can influence tumor microenvironment and metastasis. Its dual role as both a promoter and inhibitor of angiogenesis highlights its potential as a therapeutic target. The recombinant protein form of ADAMTS1 is essential for investigating its functional roles, interactions with other ECM components, and potential as a biomarker. By producing ADAMTS1 in a recombinant manner, researchers can study its enzymatic activity, protein structure, and implications in disease models, paving the way for novel therapeutic strategies in cancer and other ECM-related disorders. Understanding the molecular mechanics of ADAMTS1 through recombinant protein studies may provide insights into its regulatory functions and therapeutic potential in modulating tissue repair and pathological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US