Analytical Data
-
Gene name
ADAMTS12
- Application
-
Alternative Names
ADAMTS12；A disintegrin and metalloProteinase with thrombospondin motifs 12
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58397-2
-
Expression Region
1-229aa
-
AA Sequence
MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLP EYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEK DLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGT RVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKV PETKEPTCGLKGIVTHMSSWVEESVLFFW
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADAMTS12, a member of the ADAMTS (A Disintegrin and Metalloproteinase with Thrombospondin Motifs) family, plays a crucial role in the degradation of extracellular matrix (ECM) components and has been implicated in various physiological and pathological processes. It is particularly known for its involvement in tissue remodeling, wound healing, and inflammation. Research has shown that ADAMTS12 can interact with several matrix proteins, influencing their stability and function. Dysregulation of ADAMTS12 expression has been linked to several diseases, including cancer, arthritis, and cardiovascular diseases, highlighting its potential as a therapeutic target. The study of recombinant ADAMTS12 protein is essential for understanding its functional mechanisms and interactions at the molecular level. Producing this protein in a recombinant form enables researchers to study its structure-function relationships, elucidate its role in ECM dynamics, and explore its potential applications in disease treatment. Furthermore, understanding the enzymatic activity of ADAMTS12 and its substrate specificity could provide insights into developing targeted therapies that can modulate its activity in disease contexts. Thus, the investigation of recombinant ADAMTS12 not only advances fundamental knowledge in matrix biology but also paves the way for novel therapeutic strategies targeting ECM-related pathologies.
