Cat: PA1000-8851

Recombinant Human ADAMTS4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADAMTS4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ADAMTS4;KIAA0688;A disintegrin and metalloProteinase with thrombospondin motifs 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75173

  • Expression Region

    1-339aa

  • AA Sequence

    MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSAR LASPLPREEEIVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDS GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL GVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCNVKAPL GSPSPRPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAA KAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN TPEDSDPDHFDTAILFTRQVRPQSAPQAMHCTILRSATT

  • Molecular Weight

    62 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADAMTS4, a member of the disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS) family, is crucial for extracellular matrix (ECM) remodeling, particularly in the context of cartilage degradation. Its enzymatic activity predominantly targets aggrecan, a key component of the cartilage matrix, leading to its proteolytic cleavage. This process is significantly implicated in the development and progression of osteoarthritis (OA) and other degenerative joint diseases, where the balance between aggrecan synthesis and degradation is disrupted. Research has shown that ADAMTS4 expression is upregulated in the cartilage of OA patients, highlighting its role in disease pathology. The investigation of recombinant ADAMTS4 protein has gained attention as it offers insights into the mechanisms of cartilage breakdown and potential therapeutic strategies. By studying its structure, function, and interactions with other ECM components, researchers aim to uncover novel targets for intervention, potentially leading to the development of inhibitors that could slow down or prevent cartilage degradation in OA. Thus, the study of recombinant ADAMTS4 not only enhances our understanding of cartilage biology but also aids in addressing the clinical challenges posed by arthritic conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US