Analytical Data
-
Gene name
ADAMTS2
- Application
-
Alternative Names
ADAMTS2；PCINP；PCPNI；A disintegrin and metalloProteinase with thrombospondin motifs 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95450
-
Expression Region
254-492aa
-
AA Sequence
RRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNEQC
-
Molecular Weight
32.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADAMTS2, a member of the ADAMTS (A Disintegrin and Metalloproteinase with Thrombospondin Motifs) family, plays a crucial role in the processing of collagen precursors, particularly type I collagen, which is vital for maintaining the structural integrity and function of connective tissues. Mutations in the ADAMTS2 gene can lead to a rare genetic disorder known as Ehlers-Danlos syndrome (EDS), characterized by skin hyper-elasticity, joint hyper-mobility, and increased tendency for bruising. The study of recombinant ADAMTS2 protein is significant for understanding its enzymatic function, elucidating the molecular mechanisms underlying collagen processing, and exploring potential therapeutic strategies for EDS and related disorders. By producing and characterizing recombinant ADAMTS2, researchers can investigate its substrate specificity, enzymatic kinetics, and interactions with other extracellular matrix components. Additionally, this research offers insights into the development of biomaterials and tissue engineering applications, as ADAMTS2's role in collagen maturation is instrumental in tissue regeneration and repair. Overall, the exploration of recombinant ADAMTS2 protein not only enhances our understanding of connective tissue disorders but also paves the way for innovative treatments that address the challenges associated with collagen-related diseases.
