Analytical Data
-
Gene name
GJB4
- Application
-
Alternative Names
GJB4; Gap junction beta-4 protein; Connexin-30.3; Cx30.3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NTQ9
-
Expression Region
1-266aa
-
AA Sequence
MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
-
Molecular Weight
55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GJB4, also known as Connexin 30, is a member of the connexin family of proteins that form gap junctions, facilitating intercellular communication. Its expression is particularly prominent in various tissues, including the skin, hearing organs, and the central nervous system. Mutations in the GJB4 gene have been linked to autosomal dominant forms of hearing loss and skin disorders, demonstrating its critical role in maintaining cellular homeostasis and communication. Recent research has focused on the recombinant expression of GJB4 proteins to better understand their structure-function relationships, elucidate the mechanisms of gap junction formation, and explore their roles in pathological conditions. The production of recombinant GJB4 proteins allows for detailed studies into their biophysical properties and interactions with other cellular components. Furthermore, understanding the functionality of GJB4 has implications in regenerative medicine and therapeutic interventions for hearing loss and skin diseases. Insights gained from the study of GJB4 can pave the way for novel treatments targeting connexin-based communication pathways, enhancing our understanding of how disruptions in these pathways contribute to disease states. Overall, research on GJB4 recombinant proteins represents a promising avenue for advancing knowledge in cell biology and potential therapeutic development.
