Analytical Data
-
Gene name
FFAR1
- Application
-
Alternative Names
FFAR1;GPR40;Free fatty acid receptor 1
-
Species
Mouse
-
Source
E. coli
-
Tag
N-terminalHis-Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q76JU9
-
Expression Region
Ala102-Arg121+Gly143-Ser178+Cys201-Ala223+Ile 249-Ser256+Gly280-Lys300
-
AA Sequence
AGRYLGAAFPFGYQAIRRPRGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDP DSCYVGCLRALVRSGLSHKRKLRAAINPDLGGSGTGPGRGTICVTRTQRGTIQK
-
Molecular Weight
14.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
FFAR1, also known as Free Fatty Acid Receptor 1, is a G protein-coupled receptor that plays a crucial role in sensing free fatty acids in the body and regulating various metabolic processes. Research on FFAR1 has gained momentum due to its implications in metabolic disorders such as obesity, type 2 diabetes, and cardiovascular diseases. This receptor is primarily expressed in insulin-producing pancreatic beta cells, as well as in various tissues involved in lipid metabolism. Activation of FFAR1 by long-chain fatty acids enhances insulin secretion and promotes glucose-stimulated insulin release, highlighting its potential as a therapeutic target for improving insulin sensitivity and overall metabolic health. Additionally, FFAR1 has been linked to mechanisms of inflammation and appetite regulation, suggesting its involvement in the complex interplay between diet, metabolism, and chronic disease. Recent studies focusing on FFAR1 recombinant proteins aim to elucidate its structure-function relationship, enhancing our understanding of its signaling pathways and interactions with endogenous ligands. These investigations could pave the way for the development of novel pharmacological agents that target FFAR1, offering new strategies for the management of metabolic syndromes and related conditions. Overall, the exploration of FFAR1 and its recombinant proteins presents a promising frontier in biomedical research, with significant potential to address pressing public health challenges related to metabolic diseases.











