Analytical Data
-
Gene name
VDAC1
- Application
-
Alternative Names
VDAC1；VDAC；Voltage-dependent anion-selective channel Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21796
-
Expression Region
2-283aa
-
AA Sequence
AVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTF DSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQK VNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
-
Molecular Weight
36.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
VDAC1 (Voltage-Dependent Anion Channel 1) is a crucial mitochondrial protein that plays a significant role in regulating mitochondrial metabolism and apoptosis. It forms pores in the outer mitochondrial membrane, facilitating the exchange of ions and small molecules between the mitochondria and cytosol, thereby influencing cellular energy production and cell signaling pathways. Research on VDAC1 has gained momentum due to its involvement in various pathophysiological processes, including neurodegenerative diseases, cancer, and metabolic disorders. The recombinant expression of VDAC1 has enabled scientists to study its structure, function, and interactions with other proteins in a controlled environment. Understanding the biophysical properties and regulatory mechanisms of VDAC1 not only sheds light on mitochondrial dynamics but also presents potential therapeutic targets for diseases related to mitochondrial dysfunction. The production of VDAC1 as a recombinant protein allows for detailed investigations into its role in apoptosis and energy metabolism, thereby advancing our knowledge of cell biology and enhancing the development of novel therapeutic approaches.
