Analytical Data
-
Gene name
TIMM22
- Application
-
Alternative Names
TIMM22; TEX4; TIM22; Mitochondrial import inner membrane translocase subunit Tim22; Testis-expressed Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y584
-
Expression Region
1-194 aa
-
AA Sequence
MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR
-
Molecular Weight
46.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIMM22 is a crucial mitochondrial membrane protein involved in the import of proteins into mitochondria, specifically those destined for the inner membrane. Understanding TIMM22 and its functions is essential for elucidating mitochondrial biogenesis and protein sorting mechanisms, which are vital for cellular energy production and metabolism. The TIMM22 complex operates as a translocase, facilitating the transport of precursor proteins synthesized in the cytosol. Dysfunctions in TIMM22 and its associated pathways have been linked to various diseases, including neurological disorders and metabolic syndromes. Research has focused on the structural characterization of TIMM22 and its interaction with other mitochondrial import proteins, aiming to decipher the molecular mechanisms underpinning its operation. Advances in recombinant protein technology have enabled scientists to produce purified TIMM22 for in-depth studies, providing insights into its dynamics and functional roles in mitochondrial health. As the field progresses, understanding TIMM22's contribution to mitochondrial dysfunction could pave the way for novel therapeutic strategies for related diseases.
