Analytical Data
-
Gene name
ZG16
- Application
-
Alternative Names
hZG16; Jacalin like lectin domain containing; JCLN; JCLN1; Secretory lectin ZG16; Zg16; ZG16_HUMAN; ZG16A; Zymogen granule membrane Protein 16; Zymogen granule Protein 16; Zymogen granule Protein 16 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60844
-
Expression Region
1-167 aa
-
AA Sequence
MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC
-
Molecular Weight
44.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZG16, a member of the lectin family, is a protein that has garnered significant interest in recent years due to its potential roles in various biological processes and disease mechanisms. Initially identified as a carbohydrate-binding protein, ZG16 is predominantly expressed in the pancreas and plays an essential role in glucose metabolism and homeostasis. Researchers have investigated its function in the context of diabetes, obesity, and other metabolic disorders, revealing that ZG16 may influence insulin signaling and beta-cell function. Moreover, studies have indicated that ZG16 could be involved in inflammatory responses and may have protective effects against certain pathogens. Its unique structural characteristics and binding properties have made it a subject of interest in the fields of immunology and medical research, leading to an exploration of its potential as a therapeutic target or biomarker for metabolic diseases. Current research aims to elucidate the precise mechanisms of ZG16's actions and its interactions with other molecules, providing insights that could pave the way for novel treatment strategies in metabolic and inflammatory conditions. With advancements in molecular biology techniques, understanding ZG16's multifaceted roles in human health continues to evolve, offering promising avenues for future investigations.
