Cat: IPD-X50076

Recombinant Human PLK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PLK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PLK1;PLK;Serine/threonine-Protein kinase PLK1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P53350

  • Expression Region

    1-305aa

  • AA Sequence

    MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYV RGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSL AHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVL GCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPN YIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSI PKHINPVAASLIQKMLQTDPTARPTINELLNDEFF

  • Molecular Weight

    37.6kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PLK1 (Polo-like kinase 1) is a pivotal serine/threonine kinase that plays a crucial role in the regulation of cell cycle progression, particularly during mitosis. As a member of the polo-like kinase family, PLK1 is essential for various cellular processes, including centrosome maturation, spindle assembly, and chromosome segregation. Dysregulation of PLK1 has been implicated in several cancers, making it a promising target for therapeutic interventions. The study of recombinant PLK1 protein is vital for understanding its structure-function relationship and regulatory mechanisms in the cell cycle. Recombinant techniques allow researchers to produce PLK1 in sufficient quantities and purity for biochemical assays, structural biology studies, and drug development. By investigating PLK1's interactions with various substrates and inhibitors, scientists can elucidate its role in oncogenesis and identify potential pharmacological agents that selectively inhibit its activity. The ongoing development of PLK1 inhibitors is therefore a significant area of research in cancer therapy, as targeting this kinase could lead to the development of novel treatments that improve patient outcomes. Understanding PLK1 through recombinant protein studies not only enhances our knowledge of cell cycle regulation but also opens avenues for innovative cancer therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US