Analytical Data
-
Gene name
FABP6
- Application
-
Alternative Names
FABP6;ILBP;ILLBP;Gastrotropin
-
Species
Rat
-
Source
E. coli
-
Tag
N-terminal His-Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P80020
-
Expression Region
1-128aa
-
AA Sequence
MAFTGKYEFESEKNYDEFMKRLGLPDEVIERGRNFKIITEVQQDGENFTWSQSY SGGNIMSNKFTIGKECEMQTMGGKKFKATVKMEGGKVVADFPNYHQTSEVVGDK LVEISTIGDVTYERVSKRVA
-
Molecular Weight
17.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
Fatty acid-binding protein 6 (FABP6) is a member of the FABP family, which plays a crucial role in the intracellular transport of long-chain fatty acids and their derivatives. Research has shown that FABP6 is primarily expressed in the intestines, where it is involved in the absorption and metabolism of dietary lipids. Given its pivotal role in lipid metabolism, alterations in FABP6 expression and function have been associated with various metabolic disorders, including obesity, diabetes, and fatty liver disease. The recombinant form of FABP6 is often utilized in studies to elucidate its functional properties and interactions with fatty acids, providing insights into its physiological and pathophysiological roles. Understanding the structure-function relationship of FABP6 through recombinant protein studies can pave the way for therapeutic strategies targeting metabolic diseases. Additionally, as lipids are integral to cellular signaling processes, the investigation of FABP6 offers potential implications for diseases where lipid metabolism is disrupted. Overall, the study of recombinant FABP6 protein is essential for advancing our knowledge of lipid biology and developing interventions for metabolic disorders linked to dysregulated fatty acid metabolism.











