Cat: PA1000-5619

Recombinant Human METAP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    METAP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    METAP2;MNPEP;P67EIF2;Methionine aminopeptidase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P50579

  • Expression Region

    1-478aa

  • AA Sequence

    MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSA AGEQEPDKESGASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKK KKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGRTAAWRT TSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKL EDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKI DFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGG EATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTK HLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDI KGSYTAQFEHTILLRPTCKEVVSRGDDY

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

METAP2 (Methionine Aminopeptidase 2) is a crucial enzyme involved in the processing of nascent peptides by removing the N-terminal methionine, which plays a vital role in protein maturation and regulation. Research into METAP2 has garnered significant attention due to its implications in various biological processes and diseases. Notably, METAP2 is implicated in cancer progression, as it can affect the stability of oncogenic proteins and influence cellular signaling pathways. Loss of METAP2 function has been associated with increased cellular stress responses and altered apoptosis, contributing to tumorigenesis. Additionally, METAP2 has been identified as a potential target for therapeutic interventions, with small-molecule inhibitors being developed to modulate its activity in cancer therapy. Understanding the structure-function relationship of METAP2 and its role in protein metabolism can provide insights into its potential as a biomarker for disease and a target for drug development. Recent advances in recombinant protein technology have enabled the production of METAP2 for detailed biochemical studies, allowing researchers to investigate its enzymatic properties and interactions with various substrates. This knowledge is essential for the development of METAP2-targeted therapies and for elucidating its role in cancer and other pathologies, thereby advancing our understanding of cellular homeostasis and disease mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US