Analytical Data
-
Gene name
GPR35
- Application
-
Alternative Names
GPR35；G-Protein coupled receptor 35
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His and GST Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HC97
-
Expression Region
240-309aa
-
AA Sequence
RLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAP SAKAHKSQDSLCVTLA
-
Molecular Weight
37.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
GPR35 is a G protein-coupled receptor that has garnered interest in recent years due to its involvement in various physiological and pathological processes, including immune response, inflammation, and metabolic regulation. Identified as a receptor for kynurenic acid and certain other ligands, GPR35 is believed to play a role in gastrointestinal disorders, cardiovascular diseases, and even cancer. The complexity of its signaling pathways, which may involve β-arrestin and Gq/11 proteins, highlights the need for a deeper understanding of its mechanisms. However, challenges in obtaining functional studies of GPR35 have arisen, primarily due to difficulties in expressing and purifying the receptor in recombinant systems. As a result, a focused effort on the production of recombinant GPR35 protein has emerged, which aims to facilitate detailed pharmacological analyses and structural studies. Such research is crucial for elucidating the receptor's biological functions and potential as a therapeutic target. Advances in protein expression techniques, coupled with the development of specific ligands and antibodies, are expected to accelerate discoveries related to GPR35, potentially leading to novel interventions for diseases linked to this receptor.
