Analytical Data
-
Gene name
CNR2
-
简介
CNR2 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.
- Application
-
Alternative Names
CNR2; cannabinoid receptor 2 (macrophage); cannabinoid receptor 2; CB2
-
Species
Human
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P34972
-
Expression Region
M1-C360
-
AA Sequence
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
-
Protein Length
Full Length
-
Molecular Weight
40.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNR2, also known as cannabinoid receptor type 2, is a G protein-coupled receptor that plays a crucial role in the endocannabinoid system, which regulates various physiological processes, including pain, inflammation, and immune response. The interest in CNR2 research has surged due to its potential therapeutic applications, particularly in treating inflammatory diseases, neurodegenerative disorders, and pain management. The study of CNR2 recombinant proteins is vital for understanding the receptor's structure-function relationships and its signaling mechanisms. By expressing and purifying these proteins, researchers can investigate ligand-receptor interactions, characterize binding affinities, and elucidate downstream signaling pathways. Additionally, recombinant CNR2 proteins serve as valuable tools for drug discovery, enabling the screening of novel cannabinoids and small molecules that could modulate receptor activity. As the pharmaceutical industry looks for innovative therapies, the exploration of CNR2 and its recombinant forms may lead to breakthroughs in health care, particularly for conditions currently lacking effective treatments. Thus, the ongoing research into CNR2 recombinant proteins is not only scientifically significant but also essential for translating findings into clinical applications that can improve patient outcomes.











